(data stored in SCRATCH zone)

EMBL: CP000509.PE314

CP000509.PE314       Location/Qualifiers
FT   CDS             343211..343804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79864"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH9"
FT                   /protein_id="ABL79864.1"
FT                   /translation="MTETTIDHETEEFAQQIADQVESFLIALQAIAREADGGRAISLLL
FT                   LEISQVLLAGARLGAQRDFKPEGEYQPDVGPEPDLDEMRLRLASMLDSVDTYSFVFDPY
FT                   VPDVVESQLSDDLTSIATDLENGLRHYRLGNVDEALWWWQFSYVASWGNLAGAALNALL
FT                   SIVAHDRLDAEFTGEDEQLALADEMLEGGEPTAR"
     MTETTIDHET EEFAQQIADQ VESFLIALQA IAREADGGRA ISLLLLEISQ VLLAGARLGA        60
     QRDFKPEGEY QPDVGPEPDL DEMRLRLASM LDSVDTYSFV FDPYVPDVVE SQLSDDLTSI       120
     ATDLENGLRH YRLGNVDEAL WWWQFSYVAS WGNLAGAALN ALLSIVAHDR LDAEFTGEDE       180
     QLALADEMLE GGEPTAR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page