(data stored in SCRATCH zone)

EMBL: CP000509.PE315

CP000509.PE315       Location/Qualifiers
FT   CDS             343857..345131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0321"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tfu:Tfu_0043 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79865"
FT                   /db_xref="GOA:A1SDI0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI0"
FT                   /protein_id="ABL79865.1"
FT                   /translation="MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGD
FT                   ETDNLRDLAEQVTPLPPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVIT
FT                   DSAHGKAKIIDITPGRIEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAA
FT                   ALGAEVCEIYSDVDGVFTADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARR
FT                   YDMPIHVRSSFSQKEGTWVIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEA
FT                   ARIFEALAATEVNLDMVVQNVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKL
FT                   LYDDQIGKVSLIGAGMRSHPGITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEA
FT                   VRATHTAFDLDAEEVEAVVYGGTGR"
     MGIVVQKYGG SSVADAAGIK RVAQRIVNTR KAGHDVVVVV SAMGDETDNL RDLAEQVTPL        60
     PPPRELDMLL TAGERISMAL VAMAIAALGH EAKSFTGSQA GVITDSAHGK AKIIDITPGR       120
     IEKALKDGAI AIVAGFQGVS QDTKDVTTLG RGASDTTAVA LAAALGAEVC EIYSDVDGVF       180
     TADPRIVPAA RKLARVSTEE MLEMAASGAK ILHLRCVEYA RRYDMPIHVR SSFSQKEGTW       240
     VIPDSKAGED EMEQAIIAGV AHDRSEAKIT VVGVPDKVGE AARIFEALAA TEVNLDMVVQ       300
     NVSAAATGLT DISFTLPRAD GQSAMGALAR IQDEVGYDKL LYDDQIGKVS LIGAGMRSHP       360
     GITARFFASL AAAGVNIEMI STSEIRISVI VDEAQVDEAV RATHTAFDLD AEEVEAVVYG       420
     GTGR                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page