(data stored in ACNUC1104 zone)

EMBL: CP000509.PE32

CP000509.PE32        Location/Qualifiers
FT   CDS             35225..36823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0032"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; KEGG:
FT                   mka:MK0828 succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79582"
FT                   /db_xref="GOA:A1SCP7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP7"
FT                   /protein_id="ABL79582.1"
FT                   /translation="MSAPGVDRVEVDLVVAGGGVGGAMAAYHAARVGARVLYLGGSGGA
FT                   SARISSFNTALGYDDPDTPDGIVEDMLRAGRHVNHPGVVRALADRVAEETMRLVEMDVP
FT                   FVRDGDRLARRQAAGSTWTRAVFSRGMIGADIVRALTERLVADESVTVVNGGLLVDVET
FT                   ADGAVCGVLAWSPRDERWMQIGTRAVVMATGGAGQLWASTTNPRGSLGTGYAVALEAGA
FT                   ELMDMEFTSFEPFITSAPPEHAGHDLPTTVLREGARLLNARGEAFLPEQSPTKDIICRA
FT                   MVREVLEGRGTASGSVVFDLTEMDPDNAERYVGIVEALRKRGITSREAQLEVMPAQHYV
FT                   MGGIRIDERGRSTLPGMYAVGEAAGGAHGAHRLAAGGGLEVVAGGAVVGEAAGLDALSA
FT                   TGDRRCSLAPNPDLLSVRLAAEAQADLGLIRGAMDSGCGILRTATDLEDTVTAVEEVHQ
FT                   RHRVPGGHPFVRRAAMVALSIARSAAMREESRGDHFRTDHPHSSEEWLANIVVTAPAGE
FT                   MEFTTAPVPTATTVA"
     MSAPGVDRVE VDLVVAGGGV GGAMAAYHAA RVGARVLYLG GSGGASARIS SFNTALGYDD        60
     PDTPDGIVED MLRAGRHVNH PGVVRALADR VAEETMRLVE MDVPFVRDGD RLARRQAAGS       120
     TWTRAVFSRG MIGADIVRAL TERLVADESV TVVNGGLLVD VETADGAVCG VLAWSPRDER       180
     WMQIGTRAVV MATGGAGQLW ASTTNPRGSL GTGYAVALEA GAELMDMEFT SFEPFITSAP       240
     PEHAGHDLPT TVLREGARLL NARGEAFLPE QSPTKDIICR AMVREVLEGR GTASGSVVFD       300
     LTEMDPDNAE RYVGIVEALR KRGITSREAQ LEVMPAQHYV MGGIRIDERG RSTLPGMYAV       360
     GEAAGGAHGA HRLAAGGGLE VVAGGAVVGE AAGLDALSAT GDRRCSLAPN PDLLSVRLAA       420
     EAQADLGLIR GAMDSGCGIL RTATDLEDTV TAVEEVHQRH RVPGGHPFVR RAAMVALSIA       480
     RSAAMREESR GDHFRTDHPH SSEEWLANIV VTAPAGEMEF TTAPVPTATT VA               532
//

If you have problems or comments...

PBIL Back to PBIL home page