(data stored in ACNUC1104 zone)

EMBL: CP000509.PE321

CP000509.PE321       Location/Qualifiers
FT   CDS             351448..351759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0327"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: sco:SCO3579
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79871"
FT                   /db_xref="GOA:A1SDI6"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI6"
FT                   /protein_id="ABL79871.1"
FT                   /translation="MWVEDWAPMAACRESQPDQLFVRGAEQNKAKQLCAGCPVRTECLA
FT                   EALDNQIEWGVWGGMTERERRALLRRRPNASWRAVLEAAREQGTPAIGSKPVARPVGV"
     MWVEDWAPMA ACRESQPDQL FVRGAEQNKA KQLCAGCPVR TECLAEALDN QIEWGVWGGM        60
     TERERRALLR RRPNASWRAV LEAAREQGTP AIGSKPVARP VGV                         103
//

If you have problems or comments...

PBIL Back to PBIL home page