(data stored in ACNUC1104 zone)

EMBL: CP000509.PE322

CP000509.PE322       Location/Qualifiers
FT   CDS             complement(351885..353093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0328"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: tfu:Tfu_0111
FT                   putative ion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79872"
FT                   /db_xref="GOA:A1SDI7"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI7"
FT                   /protein_id="ABL79872.1"
FT                   /translation="MSTARKTRTRTRVGPLATAPTAAPALDVDALLDDRGTGIIVCCGS
FT                   GGVGKTTASAALALRAAERGRRVVVLTIDPARRLAQSMGIEQLDNTPRPVTGLRTNAKG
FT                   NRKGGGLDAMMLDMKRTFDEVVESQANPEKARLILDNPFYIALSSSFAGTQEYMAMEKL
FT                   GQLHADARRDGTYDLIVVDTPPSRSALDFLDAPERLSSFLDGRFIRLLLTPARGPARMM
FT                   TAGLGLITNALNRILGTQVLRDMQTFVAAFDTLFGGFRVRAQKTFELLQADGTAFLVVA
FT                   APEPDALREAAYFVERLSEDDMPLAGLIVNRATPVPPGSLSADEAMAASERLRKQDPDS
FT                   LTAGLLCLHADQTRIVEREALLRDRFAAAHPQVPTAVVPALAGDVHDLDGLRRVGELLA
FT                   RSG"
     MSTARKTRTR TRVGPLATAP TAAPALDVDA LLDDRGTGII VCCGSGGVGK TTASAALALR        60
     AAERGRRVVV LTIDPARRLA QSMGIEQLDN TPRPVTGLRT NAKGNRKGGG LDAMMLDMKR       120
     TFDEVVESQA NPEKARLILD NPFYIALSSS FAGTQEYMAM EKLGQLHADA RRDGTYDLIV       180
     VDTPPSRSAL DFLDAPERLS SFLDGRFIRL LLTPARGPAR MMTAGLGLIT NALNRILGTQ       240
     VLRDMQTFVA AFDTLFGGFR VRAQKTFELL QADGTAFLVV AAPEPDALRE AAYFVERLSE       300
     DDMPLAGLIV NRATPVPPGS LSADEAMAAS ERLRKQDPDS LTAGLLCLHA DQTRIVEREA       360
     LLRDRFAAAH PQVPTAVVPA LAGDVHDLDG LRRVGELLAR SG                          402
//

If you have problems or comments...

PBIL Back to PBIL home page