(data stored in SCRATCH zone)

EMBL: CP000509.PE323

CP000509.PE323       Location/Qualifiers
FT   CDS             complement(353090..354118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0329"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: sco:SCO3577
FT                   ion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79873"
FT                   /db_xref="GOA:A1SDI8"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI8"
FT                   /protein_id="ABL79873.1"
FT                   /translation="MAPPTTTPTTTPDWSRVRLHVVTGKGGTGKSTVAAALALGLASQG
FT                   QQVLLCEVEGRQGIARMFDVDPLPYEERRIATGLHHDGRPPGVVHALHIDAESALLEYL
FT                   AMYYKLGRAGRALDRFGVIEFATTIAPGVRDVLLTGKVFEAVQRNSRNRNATRYDAVVL
FT                   DAPPTGRITQFLNVNEELAGLAKVGPIKGQADTVMTLFRSPRTLVHLVTVLEEMPVQET
FT                   ADGISELRAARLPVGAVIVNQVRPRDITPADLEAAVAGRLDTARIEADLDQAGVTGGTA
FT                   LVEGLIAEVRDHAERRALEDAQRAVVDSFGLPTYELPRLTSGVDLGGLYELAADLKNQG
FT                   LA"
     MAPPTTTPTT TPDWSRVRLH VVTGKGGTGK STVAAALALG LASQGQQVLL CEVEGRQGIA        60
     RMFDVDPLPY EERRIATGLH HDGRPPGVVH ALHIDAESAL LEYLAMYYKL GRAGRALDRF       120
     GVIEFATTIA PGVRDVLLTG KVFEAVQRNS RNRNATRYDA VVLDAPPTGR ITQFLNVNEE       180
     LAGLAKVGPI KGQADTVMTL FRSPRTLVHL VTVLEEMPVQ ETADGISELR AARLPVGAVI       240
     VNQVRPRDIT PADLEAAVAG RLDTARIEAD LDQAGVTGGT ALVEGLIAEV RDHAERRALE       300
     DAQRAVVDSF GLPTYELPRL TSGVDLGGLY ELAADLKNQG LA                          342
//

If you have problems or comments...

PBIL Back to PBIL home page