(data stored in ACNUC1104 zone)

EMBL: CP000509.PE326

CP000509.PE326       Location/Qualifiers
FT   CDS             complement(355713..356549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0332"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: lxx:Lxx06230 RNA
FT                   polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79876"
FT                   /db_xref="GOA:A1SDJ1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ1"
FT                   /protein_id="ABL79876.1"
FT                   /translation="MTIAERDQLAVQHVPLVAHLVRETMARVPSYMDRNDLHSAGLLAL
FT                   VQAARAFDPERGVPFAGYASTRIRGALVDELRSVDWASRSVRRRAREIEAARARLAATL
FT                   GQFPDDAAVAEALGITPEEIGKADSEVARAVVLPLDAGPNAGFVESLAGRDPGPEEEAL
FT                   HAERAQYLAAAIEELPERLRHVVRGYFVAQRPMAELAAELGVSESRISQLRAEALVLLR
FT                   DALAEAFEPHLAAPHPNPDGVAARRRLAYTSAVAARYAARRTMPAARVREGLSSIA"
     MTIAERDQLA VQHVPLVAHL VRETMARVPS YMDRNDLHSA GLLALVQAAR AFDPERGVPF        60
     AGYASTRIRG ALVDELRSVD WASRSVRRRA REIEAARARL AATLGQFPDD AAVAEALGIT       120
     PEEIGKADSE VARAVVLPLD AGPNAGFVES LAGRDPGPEE EALHAERAQY LAAAIEELPE       180
     RLRHVVRGYF VAQRPMAELA AELGVSESRI SQLRAEALVL LRDALAEAFE PHLAAPHPNP       240
     DGVAARRRLA YTSAVAARYA ARRTMPAARV REGLSSIA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page