(data stored in ACNUC1104 zone)

EMBL: CP000509.PE327

CP000509.PE327       Location/Qualifiers
FT   CDS             356811..357617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0333"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   lxx:Lxx06230 RNA polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79877"
FT                   /db_xref="GOA:A1SDJ2"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ2"
FT                   /protein_id="ABL79877.1"
FT                   /translation="MPERARLCLTCRVTINAPGPAPTVDPARLAAHHLPLVAHLVYDTL
FT                   RRVPAAVDRHDLLAVGVDALLAAAREPTVERPFAEHASVRIRAALVEELRAIDWAARAE
FT                   HPRHAASARARLLAALADLPDAGAAARVLDVDHDPAEAEEGSPAVVGGTTRPAHPDRRD
FT                   ERREYVEAALDELPERLRLVVRGYFVEQRPMAAVAAQVGASEARAVQLLVEGLGLLRDA
FT                   LALAFGPSADAGPVTSTRAASYARTVAARYAARPVRAPREEQRTSA"
     MPERARLCLT CRVTINAPGP APTVDPARLA AHHLPLVAHL VYDTLRRVPA AVDRHDLLAV        60
     GVDALLAAAR EPTVERPFAE HASVRIRAAL VEELRAIDWA ARAEHPRHAA SARARLLAAL       120
     ADLPDAGAAA RVLDVDHDPA EAEEGSPAVV GGTTRPAHPD RRDERREYVE AALDELPERL       180
     RLVVRGYFVE QRPMAAVAAQ VGASEARAVQ LLVEGLGLLR DALALAFGPS ADAGPVTSTR       240
     AASYARTVAA RYAARPVRAP REEQRTSA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page