(data stored in ACNUC1104 zone)

EMBL: CP000509.PE328

CP000509.PE328       Location/Qualifiers
FT   CDS             357823..358725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0334"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: lxx:Lxx06230 RNA
FT                   polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79878"
FT                   /db_xref="GOA:A1SDJ3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ3"
FT                   /protein_id="ABL79878.1"
FT                   /translation="MTDPEVNEPDTPTAATSGPGPRPGSAEADRLAVEHVPLVTHVVYE
FT                   TLARVPSYVDRNDLRSAGLLALVAAARSFDPERGVPFARYAMPRIRGAMVDELRSVDWA
FT                   SRSVRRRAREIEEARARLAATLGEFPDDEAVAAALGMTLDEVNRVDSEAARGTVLPLDA
FT                   GAQQGLAEILPVREAGPEERAVHLERVRYLADAVEELPERMRLVVRGYFLEERPMAELA
FT                   AELGVTESRVSQVRAEALALLRDALGEAFDPHLPKPHPNPAGVAARRRLAYTSAVAARY
FT                   AARRTMPARRPHRGLESTA"
     MTDPEVNEPD TPTAATSGPG PRPGSAEADR LAVEHVPLVT HVVYETLARV PSYVDRNDLR        60
     SAGLLALVAA ARSFDPERGV PFARYAMPRI RGAMVDELRS VDWASRSVRR RAREIEEARA       120
     RLAATLGEFP DDEAVAAALG MTLDEVNRVD SEAARGTVLP LDAGAQQGLA EILPVREAGP       180
     EERAVHLERV RYLADAVEEL PERMRLVVRG YFLEERPMAE LAAELGVTES RVSQVRAEAL       240
     ALLRDALGEA FDPHLPKPHP NPAGVAARRR LAYTSAVAAR YAARRTMPAR RPHRGLESTA       300
//

If you have problems or comments...

PBIL Back to PBIL home page