(data stored in SCRATCH zone)

EMBL: CP000509.PE329

CP000509.PE329       Location/Qualifiers
FT   CDS             358835..358990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79879"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ4"
FT                   /protein_id="ABL79879.1"
FT                   /translation="MTKWEYLTAPILTHAAKQILDNFGADGWELVQVAPGPNPENLVGF
FT                   FKRPLA"
     MTKWEYLTAP ILTHAAKQIL DNFGADGWEL VQVAPGPNPE NLVGFFKRPL A                 51
//

If you have problems or comments...

PBIL Back to PBIL home page