(data stored in ACNUC1104 zone)

EMBL: CP000509.PE330

CP000509.PE330       Location/Qualifiers
FT   CDS             358987..359451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0336"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sco:SCO3575
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79880"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ5"
FT                   /protein_id="ABL79880.1"
FT                   /translation="MTSPEERLAELGLAVPDVAKPVAVYVPAVVSGDLVFTSGQLPMRD
FT                   GELMVTGKVGGEVSPEEAALCAQQCALNAIAAVKSMVGDLDRVAQVVKVVAFVASTPDF
FT                   TGQPQVANGASELFGKVFGDRGAHARSAVGVPVLPLDAPVEVEIVVRVAS"
     MTSPEERLAE LGLAVPDVAK PVAVYVPAVV SGDLVFTSGQ LPMRDGELMV TGKVGGEVSP        60
     EEAALCAQQC ALNAIAAVKS MVGDLDRVAQ VVKVVAFVAS TPDFTGQPQV ANGASELFGK       120
     VFGDRGAHAR SAVGVPVLPL DAPVEVEIVV RVAS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page