(data stored in SCRATCH zone)

EMBL: CP000509.PE332

CP000509.PE332       Location/Qualifiers
FT   CDS             360390..361157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0338"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO3572 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79882"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ7"
FT                   /protein_id="ABL79882.1"
FT                   /translation="MLAANPGPMTLDGTNTWVLREPGARRSVVVDPGPALPAHLDAIAA
FT                   EAGEVGVVLLTHHHADHAEAARAFAERVGCGVRALDPAYRLGAEGLGDGDVVAVDGLEI
FT                   RVVGTPGHTADSLSFLLPAEGAVLTGDTVLGRGTTVVAHPDGQLGAYLGSLDRLHALAE
FT                   AHEVASIWPGHGPVIVNALGALDHYLAHRQERLEQVRAAVETLQAAHRPEGIAAEELPR
FT                   RVVEIVYADVDPVLWGAAELSVRAQLAYLAEPR"
     MLAANPGPMT LDGTNTWVLR EPGARRSVVV DPGPALPAHL DAIAAEAGEV GVVLLTHHHA        60
     DHAEAARAFA ERVGCGVRAL DPAYRLGAEG LGDGDVVAVD GLEIRVVGTP GHTADSLSFL       120
     LPAEGAVLTG DTVLGRGTTV VAHPDGQLGA YLGSLDRLHA LAEAHEVASI WPGHGPVIVN       180
     ALGALDHYLA HRQERLEQVR AAVETLQAAH RPEGIAAEEL PRRVVEIVYA DVDPVLWGAA       240
     ELSVRAQLAY LAEPR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page