(data stored in ACNUC1104 zone)

EMBL: CP000509.PE333

CP000509.PE333       Location/Qualifiers
FT   CDS             complement(361275..361952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0339"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: tfu:Tfu_0117 cyclic nucleotide-binding:bacterial
FT                   regulatory protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79883"
FT                   /db_xref="GOA:A1SDJ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ8"
FT                   /protein_id="ABL79883.1"
FT                   /translation="MDNDVLRQAPLFSALDDEAATALRASMTESKLRRGDVLFHEGDSG
FT                   DKLYIVLDGKVKLGRTSSDGRENLLAILGPGQMFGELSLFDPGPRSATVTAVTDATFAS
FT                   LSHEDLLRWLEGRPVVARGLLTQLAGRLRKANDVVADLVFSDVPGRVAKALLDLADRFG
FT                   RSADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVIMDVERLGR
FT                   RAR"
     MDNDVLRQAP LFSALDDEAA TALRASMTES KLRRGDVLFH EGDSGDKLYI VLDGKVKLGR        60
     TSSDGRENLL AILGPGQMFG ELSLFDPGPR SATVTAVTDA TFASLSHEDL LRWLEGRPVV       120
     ARGLLTQLAG RLRKANDVVA DLVFSDVPGR VAKALLDLAD RFGRSADDGV HVHHDLTQEE       180
     LAQLVGASRE TVNKALADFA SRGWLRLEPR SVVIMDVERL GRRAR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page