(data stored in ACNUC1104 zone)

EMBL: CP000509.PE334

CP000509.PE334       Location/Qualifiers
FT   CDS             362084..362815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0340"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sma:SAV4593 putative endonuclease III;
FT                   TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix motif;
FT                   HhH-GPD family protein; SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79884"
FT                   /db_xref="GOA:A1SDJ9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ9"
FT                   /protein_id="ABL79884.1"
FT                   /translation="MPRRTLGPVPAVPESRTGLVRRARKIDRLLAETYPDARCELDFDN
FT                   PFELLVVTVLSAQTTDKRVNAVRPTLFAAYPDARTMAGADRATLEGIVGPLGFFRAKTE
FT                   SLLKLSAALVERHGGEVPPRLDDLVQLPGVGRKTANVVLGNAFGIPGITVDTHFGRLSR
FT                   RFAWTEETDPVKVEHAVGALFEKRDWTMLSHHLIWHGRRICHARNPACGACPVARWCPA
FT                   YGEGPTDPAAAAKLVKTEGRA"
     MPRRTLGPVP AVPESRTGLV RRARKIDRLL AETYPDARCE LDFDNPFELL VVTVLSAQTT        60
     DKRVNAVRPT LFAAYPDART MAGADRATLE GIVGPLGFFR AKTESLLKLS AALVERHGGE       120
     VPPRLDDLVQ LPGVGRKTAN VVLGNAFGIP GITVDTHFGR LSRRFAWTEE TDPVKVEHAV       180
     GALFEKRDWT MLSHHLIWHG RRICHARNPA CGACPVARWC PAYGEGPTDP AAAAKLVKTE       240
     GRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page