(data stored in ACNUC1104 zone)

EMBL: CP000509.PE336

CP000509.PE336       Location/Qualifiers
FT   CDS             363420..364139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0342"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sma:SAV4594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79886"
FT                   /db_xref="GOA:A1SDK1"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK1"
FT                   /protein_id="ABL79886.1"
FT                   /translation="MIPDWLVPVRDGAAAISADQLTRFTPPAGGDARRGAVLMLFGAGE
FT                   QGGELLLTERAHDMRSHPGQVSFPGGALDPGETPVEAALREAEEEVGVDPASVEVFGRL
FT                   PELWLPPSNFAVTPVLGWWREPGDVSIVSQAEVHAIHHVPISELLDPEHRITVRHPRGG
FT                   YQSPGFLIGPDHDVVLWGFTGGIIARLFDFLGWTRPWDESRLRDLPSYMLQADPRRGRL
FT                   LDIEDDQDDDQDEEEDG"
     MIPDWLVPVR DGAAAISADQ LTRFTPPAGG DARRGAVLML FGAGEQGGEL LLTERAHDMR        60
     SHPGQVSFPG GALDPGETPV EAALREAEEE VGVDPASVEV FGRLPELWLP PSNFAVTPVL       120
     GWWREPGDVS IVSQAEVHAI HHVPISELLD PEHRITVRHP RGGYQSPGFL IGPDHDVVLW       180
     GFTGGIIARL FDFLGWTRPW DESRLRDLPS YMLQADPRRG RLLDIEDDQD DDQDEEEDG        239
//

If you have problems or comments...

PBIL Back to PBIL home page