(data stored in ACNUC1104 zone)

EMBL: CP000509.PE34

CP000509.PE34        Location/Qualifiers
FT   CDS             37757..38983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0034"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   fal:FRAAL3119 conserved hypothetical protein; putative
FT                   cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79584"
FT                   /db_xref="GOA:A1SCP9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP9"
FT                   /protein_id="ABL79584.1"
FT                   /translation="MSGSPRRPRVGVVGGGIVGAAVARELLARYDAEVVLWEKEDGLGR
FT                   HQTGHNSGVVHAGVYYTPGSHKARLCVQGGRLLRAFCEERGLVYEECGKLIVATDEGQR
FT                   SLLHDIERRGRSNGVTGLRWLEGEEIGSVEPHARGVAALHSPRTAIVDYGAVTRALGAE
FT                   VVDRGGLLHVGTAVTGLQTRGREVVVTTSAGSQVVDLVVACAGLHADRVARMAGDDSEP
FT                   MIVPFRGEYHVLRPDRSALVRGMIYPVPDPRYPFLGVHLTRHVDGSVSIGPNAVLALAR
FT                   EGYRWRDVAGRDLWEMARWPGFARLARRHWRTGVRELAGSASKRRFVAAARLYVPELRV
FT                   ADVERRVAGVRAQAVDRDGTLVDDFRIGRAGRVLSVRNAPSPAATSSLAIAAEVVAMLA
FT                   DDLPRRSGG"
     MSGSPRRPRV GVVGGGIVGA AVARELLARY DAEVVLWEKE DGLGRHQTGH NSGVVHAGVY        60
     YTPGSHKARL CVQGGRLLRA FCEERGLVYE ECGKLIVATD EGQRSLLHDI ERRGRSNGVT       120
     GLRWLEGEEI GSVEPHARGV AALHSPRTAI VDYGAVTRAL GAEVVDRGGL LHVGTAVTGL       180
     QTRGREVVVT TSAGSQVVDL VVACAGLHAD RVARMAGDDS EPMIVPFRGE YHVLRPDRSA       240
     LVRGMIYPVP DPRYPFLGVH LTRHVDGSVS IGPNAVLALA REGYRWRDVA GRDLWEMARW       300
     PGFARLARRH WRTGVRELAG SASKRRFVAA ARLYVPELRV ADVERRVAGV RAQAVDRDGT       360
     LVDDFRIGRA GRVLSVRNAP SPAATSSLAI AAEVVAMLAD DLPRRSGG                    408
//

If you have problems or comments...

PBIL Back to PBIL home page