(data stored in SCRATCH zone)

EMBL: CP000509.PE341

CP000509.PE341       Location/Qualifiers
FT   CDS             complement(369471..371075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0347"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: sco:SCO1822 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79891"
FT                   /db_xref="GOA:A1SDK6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK6"
FT                   /protein_id="ABL79891.1"
FT                   /translation="MSSDTLTAILFIGVVLITIAITFWASRQNKGTADFYAAGRSFSGF
FT                   QNGMAISGDYMSAASFLGISGAIALYGYDGFLYSIGFLVAWLVALLLVAELLRNSGRYT
FT                   MADQLAYRMRQRPVRTAASTSTVVVSIFYLLAQMVGAGALVALLLGADSEAAKNATIIG
FT                   VGVLMIFYVTVGGMKGTTWVQIVKAVLLMGGTILITILVLAKFNFNISDLLGAAAANTG
FT                   KGDAFLQPGLKYGIDTTAKIDFLSLGLALVLGTAGLPHILIRFYTVPSAKAARTSVLWA
FT                   IGLIGAFYLMTLALGFGAAALLDTGAGSKVAASGGNLASPLLAEAVGGGDGTTGGAVLL
FT                   ALISAVAFATILAVVAGLTLTSASSVAHDLYATVFKKGAATERDEVRVARLSAFVIGGI
FT                   AIALAIPAQKLNIAFLVALAFAVAASANLPSLIYNLFWRRFNTRGATWAIYGGLIASVG
FT                   LVFFSPVVSGSETALFTGQDWSYFPLSNPGIISIPLGFFFGWLGTVTSQEPESAARFTE
FT                   LEVRAFTGAGAEQAVRH"
     MSSDTLTAIL FIGVVLITIA ITFWASRQNK GTADFYAAGR SFSGFQNGMA ISGDYMSAAS        60
     FLGISGAIAL YGYDGFLYSI GFLVAWLVAL LLVAELLRNS GRYTMADQLA YRMRQRPVRT       120
     AASTSTVVVS IFYLLAQMVG AGALVALLLG ADSEAAKNAT IIGVGVLMIF YVTVGGMKGT       180
     TWVQIVKAVL LMGGTILITI LVLAKFNFNI SDLLGAAAAN TGKGDAFLQP GLKYGIDTTA       240
     KIDFLSLGLA LVLGTAGLPH ILIRFYTVPS AKAARTSVLW AIGLIGAFYL MTLALGFGAA       300
     ALLDTGAGSK VAASGGNLAS PLLAEAVGGG DGTTGGAVLL ALISAVAFAT ILAVVAGLTL       360
     TSASSVAHDL YATVFKKGAA TERDEVRVAR LSAFVIGGIA IALAIPAQKL NIAFLVALAF       420
     AVAASANLPS LIYNLFWRRF NTRGATWAIY GGLIASVGLV FFSPVVSGSE TALFTGQDWS       480
     YFPLSNPGII SIPLGFFFGW LGTVTSQEPE SAARFTELEV RAFTGAGAEQ AVRH             534
//

If you have problems or comments...

PBIL Back to PBIL home page