(data stored in ACNUC1104 zone)

EMBL: CP000509.PE342

CP000509.PE342       Location/Qualifiers
FT   CDS             complement(371072..371434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0348"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   sma:SAV6453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79892"
FT                   /db_xref="GOA:A1SDK7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK7"
FT                   /protein_id="ABL79892.1"
FT                   /translation="MSDLDQTAGQAHRHDPVYDELHASPEFNRLRSLYRGFAFPATIAF
FT                   LAWYLLYVVMSNWATGFMDTKLSGNINLALVFGLLQFLTTFAIAWLYARYMNRNVDPIA
FT                   RALEKKYNDRPGGGAR"
     MSDLDQTAGQ AHRHDPVYDE LHASPEFNRL RSLYRGFAFP ATIAFLAWYL LYVVMSNWAT        60
     GFMDTKLSGN INLALVFGLL QFLTTFAIAW LYARYMNRNV DPIARALEKK YNDRPGGGAR       120
//

If you have problems or comments...

PBIL Back to PBIL home page