(data stored in ACNUC1104 zone)

EMBL: CP000509.PE343

CP000509.PE343       Location/Qualifiers
FT   CDS             371696..373204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0349"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr2806 nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79893"
FT                   /db_xref="GOA:A1SDK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK8"
FT                   /protein_id="ABL79893.1"
FT                   /translation="MALTSLHTDAAEASPIRRRTGRWIDDWRPEDPDFWANGGQQVARR
FT                   NLVWSVFAEHLGFSVWLIWSVSSAFLLAQGFTFTPQQLFLLVAIPNLVGSLLRVPYTLA
FT                   VPRFGGRNWTMVSAGLLLVPTLGFAYAVTDPSTPYWVFCLIAASAGFGGGNFASSMANI
FT                   NFFYPTAKKGAALGLNAAGGNLGVSLIQFFLPLIVGGAAIFGLAKASPGGIHLERAAWV
FT                   YAGLAIVATAAAYFFMDNLGTARSSAREQLGVLKHKQTWVMSFLYIGTFGSFIGYSAAM
FT                   PLLIKLNFWVPEPAPLGTGIYFAYFAFLGALVGSITRPLGGWLADRYGGARVTLGAFTG
FT                   IILSTLGVLWTLLQLTPNPAADPAIAADNKSWFPYFLGFFLLVFAATGIGNGSTYKMIP
FT                   AIFRTEAERATAVGTEERTAALLAATKRASAAIGIIGAVGAIGGFLIPITFSSPWVSDP
FT                   MEATKTAFVIFTVFYLACAATTWVVYLRRPAEHKAHLSYAGAGI"
     MALTSLHTDA AEASPIRRRT GRWIDDWRPE DPDFWANGGQ QVARRNLVWS VFAEHLGFSV        60
     WLIWSVSSAF LLAQGFTFTP QQLFLLVAIP NLVGSLLRVP YTLAVPRFGG RNWTMVSAGL       120
     LLVPTLGFAY AVTDPSTPYW VFCLIAASAG FGGGNFASSM ANINFFYPTA KKGAALGLNA       180
     AGGNLGVSLI QFFLPLIVGG AAIFGLAKAS PGGIHLERAA WVYAGLAIVA TAAAYFFMDN       240
     LGTARSSARE QLGVLKHKQT WVMSFLYIGT FGSFIGYSAA MPLLIKLNFW VPEPAPLGTG       300
     IYFAYFAFLG ALVGSITRPL GGWLADRYGG ARVTLGAFTG IILSTLGVLW TLLQLTPNPA       360
     ADPAIAADNK SWFPYFLGFF LLVFAATGIG NGSTYKMIPA IFRTEAERAT AVGTEERTAA       420
     LLAATKRASA AIGIIGAVGA IGGFLIPITF SSPWVSDPME ATKTAFVIFT VFYLACAATT       480
     WVVYLRRPAE HKAHLSYAGA GI                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page