(data stored in SCRATCH zone)

EMBL: CP000509.PE344

CP000509.PE344       Location/Qualifiers
FT   CDS             373204..375246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0350"
FT                   /product="assimilatory nitrate reductase (NADH) alpha
FT                   subunit apoprotein"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: fra:Francci3_0863 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79894"
FT                   /db_xref="GOA:A1SDK9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK9"
FT                   /protein_id="ABL79894.1"
FT                   /translation="MTQTHCPYCSLQCGMRLEGGRRLEVRPWPEFPVNEGALCRKGWTA
FT                   AGLRGHRERLTTPLIRDRATGELRAAGWDEALDLVASRLCGLRDEHGPDSVAVFGGGGL
FT                   TNEKAYQLGKLARVALGTSQVDYNGRWCMSSAASAGNRALGIDRGLPFPLADVEHTDVL
FT                   VLVGSNLAETMPPAARHLDRLRENGGRVVVVDPRRTPTAERADLFLQPVPGTDLPLALG
FT                   LLHLLDAAGAVAEEYVAARTTGWEEVRRSLAGWWPERVERVAGVQASQLRECADLLAGA
FT                   ERVMVLTARGAEQHAQGTDTVLAWIDLALALGMPGKQYAGYGCLTGQGNGQGGREHGQK
FT                   ADQLPGYRMIDDPLARDHVAEVWGVSTDSLPGPGRSAYELLDSLGTGGGPRALLVVGSN
FT                   IVVSAPNATHVASRLAALDLLVVADLVLSETAAQADVVLPVAQWAEETGTMTNLEGRVI
FT                   LRERAVAPPEGVRTDLEVIAGLAERLGSPVPFAVDPEEVFAELGRASSGGRADYSGIGY
FT                   DRIRDEHGVFWPCPSPDHPGTPRLFAESFPTADGRARFVAVEHRGPAEPTDPSYPIHLT
FT                   TGRVLAQYQSGAQTRRVRELPDEGPFVEMHPMLAARIGAHDGQQVVVTTRRGELRVPAR
FT                   VTATIRPDTVFVPFHWVGANRLTHDALDPASRMPEFKVCAAAVRA"
     MTQTHCPYCS LQCGMRLEGG RRLEVRPWPE FPVNEGALCR KGWTAAGLRG HRERLTTPLI        60
     RDRATGELRA AGWDEALDLV ASRLCGLRDE HGPDSVAVFG GGGLTNEKAY QLGKLARVAL       120
     GTSQVDYNGR WCMSSAASAG NRALGIDRGL PFPLADVEHT DVLVLVGSNL AETMPPAARH       180
     LDRLRENGGR VVVVDPRRTP TAERADLFLQ PVPGTDLPLA LGLLHLLDAA GAVAEEYVAA       240
     RTTGWEEVRR SLAGWWPERV ERVAGVQASQ LRECADLLAG AERVMVLTAR GAEQHAQGTD       300
     TVLAWIDLAL ALGMPGKQYA GYGCLTGQGN GQGGREHGQK ADQLPGYRMI DDPLARDHVA       360
     EVWGVSTDSL PGPGRSAYEL LDSLGTGGGP RALLVVGSNI VVSAPNATHV ASRLAALDLL       420
     VVADLVLSET AAQADVVLPV AQWAEETGTM TNLEGRVILR ERAVAPPEGV RTDLEVIAGL       480
     AERLGSPVPF AVDPEEVFAE LGRASSGGRA DYSGIGYDRI RDEHGVFWPC PSPDHPGTPR       540
     LFAESFPTAD GRARFVAVEH RGPAEPTDPS YPIHLTTGRV LAQYQSGAQT RRVRELPDEG       600
     PFVEMHPMLA ARIGAHDGQQ VVVTTRRGEL RVPARVTATI RPDTVFVPFH WVGANRLTHD       660
     ALDPASRMPE FKVCAAAVRA                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page