(data stored in ACNUC1104 zone)

EMBL: CP000509.PE345

CP000509.PE345       Location/Qualifiers
FT   CDS             375404..376786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0351"
FT                   /product="assimilatory nitrate reductase (NADH) beta
FT                   subunit"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: mmc:Mmcs_3231 nitrite reductase (NAD(P)H)
FT                   large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79895"
FT                   /db_xref="GOA:A1SDL0"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL0"
FT                   /protein_id="ABL79895.1"
FT                   /translation="MRVVVVGAGMAAARLADGLHDHDVTLLGDEPHPPYNRILLSAVLE
FT                   GTHDPTAIAMPLRGDVDLRLGTRVVEIHREDRDVELADRSRVPYDRLVLATGSIPTLPP
FT                   IRGLVRMDGRLDERVHAFRSLEDCRRLDVAVPAAHRAVVVGGGLLGLQVARALAVRGVA
FT                   TEVVEGGDHLLRSQVGPRAGAILARDLGRLGTRVYTGARAVRLTDEGLRLDNGYTLATD
FT                   LVVLTAGGRPSTALARRAGLEVRRGIVVDERLRTSDHRIHAIGDCAQHGTQVTGFVPPA
FT                   WEQAGLLARQLRGEDVTYAGSRSVARLRATGLEVAVLGEPERAEGQVVEVANPVTGTHR
FT                   KLVVRDGVIVAATLVGDLSRIGLITQHYDRGTVLGASEPGDLLIGDRPAAQVDLPDDAE
FT                   VCACAGVSAGAIRACASLADARETTRATTGCGGCAAAVRQLLAARLSPGPSLGTTLEGT
FT                   PR"
     MRVVVVGAGM AAARLADGLH DHDVTLLGDE PHPPYNRILL SAVLEGTHDP TAIAMPLRGD        60
     VDLRLGTRVV EIHREDRDVE LADRSRVPYD RLVLATGSIP TLPPIRGLVR MDGRLDERVH       120
     AFRSLEDCRR LDVAVPAAHR AVVVGGGLLG LQVARALAVR GVATEVVEGG DHLLRSQVGP       180
     RAGAILARDL GRLGTRVYTG ARAVRLTDEG LRLDNGYTLA TDLVVLTAGG RPSTALARRA       240
     GLEVRRGIVV DERLRTSDHR IHAIGDCAQH GTQVTGFVPP AWEQAGLLAR QLRGEDVTYA       300
     GSRSVARLRA TGLEVAVLGE PERAEGQVVE VANPVTGTHR KLVVRDGVIV AATLVGDLSR       360
     IGLITQHYDR GTVLGASEPG DLLIGDRPAA QVDLPDDAEV CACAGVSAGA IRACASLADA       420
     RETTRATTGC GGCAAAVRQL LAARLSPGPS LGTTLEGTPR                             460
//

If you have problems or comments...

PBIL Back to PBIL home page