(data stored in ACNUC1104 zone)

EMBL: CP000509.PE346

CP000509.PE346       Location/Qualifiers
FT   CDS             376783..379299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0352"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: fal:FRAAL1355
FT                   nitrite reductase, large subunit, nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79896"
FT                   /db_xref="GOA:A1SDL1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL1"
FT                   /protein_id="ABL79896.1"
FT                   /translation="MSPKHRRTLLVAGHGMVGHRFVQAAIERGLTETHDIVVVGEERRP
FT                   AYDRVALTSFFEVGADELSFLPSGEYDDPRVRLLLGTSVDGFDPATRTVVLSDGQEIAY
FT                   DELVLATGAMPFVPPVPGHDLEGCFVYRTIEDLEAIRAAAATAEVGAVVGGGLLGLEAA
FT                   NALAQLGLVTHVVEMAPRLMAVQVDEAGGATLARHIERLGLTVHTGATTQRILGADRVE
FT                   GLALAGEEPIPADLVVFSAGIRPRDQLARDAGLDVAERGGVLVDERCRTSDPHVWAIGE
FT                   CAAPGGRMYGLVAPGYAMAEVVVDALLGGSGAFTGADLSTKLKLLGVDVASFGDAFAAT
FT                   EGALELVYADAVTGVYKKLVLSADGRQLLGGILVGDASAYGVLRPMVASGIALPDNPED
FT                   LILPTGRGVLEIGLPDEAQVCSCNDVTKGDILAAAAAGTSTRAGATCGSCKAQTKRIIE
FT                   DYYASQGKVVDRSLCEHFALTRQELFDVVAVHGYTRFDDIVAGHGRGRGCDICKPAIAS
FT                   ILASQLNGHVLDGPNRTLQDTNDAYLANIQRNGTYSVVPRIPGGEITPEKLIVIGEVAQ
FT                   EFGLYTKITGGQRIDLFGARMEQLPAIWRRLVDSGFESGHAYGKSLRTVKSCVGSTWCR
FT                   YGVQDSVQLAIDLELRYRGLRSPHKLKGGVSGCARECAEARAKDFGVIATEKGWNLYVG
FT                   GNGGATPAHARLLAGDLDRETLVRYLDRFLMYYVRTADRLQRTASWIDSIDGGLDRVRE
FT                   IVVDDALGLGSELEAAMARHVAGYFDEWRATLDDPAKLARFVSFVNAPGTPDPHITFRS
FT                   ERDQAVPEESSGPVDLGATIPVGAPR"
     MSPKHRRTLL VAGHGMVGHR FVQAAIERGL TETHDIVVVG EERRPAYDRV ALTSFFEVGA        60
     DELSFLPSGE YDDPRVRLLL GTSVDGFDPA TRTVVLSDGQ EIAYDELVLA TGAMPFVPPV       120
     PGHDLEGCFV YRTIEDLEAI RAAAATAEVG AVVGGGLLGL EAANALAQLG LVTHVVEMAP       180
     RLMAVQVDEA GGATLARHIE RLGLTVHTGA TTQRILGADR VEGLALAGEE PIPADLVVFS       240
     AGIRPRDQLA RDAGLDVAER GGVLVDERCR TSDPHVWAIG ECAAPGGRMY GLVAPGYAMA       300
     EVVVDALLGG SGAFTGADLS TKLKLLGVDV ASFGDAFAAT EGALELVYAD AVTGVYKKLV       360
     LSADGRQLLG GILVGDASAY GVLRPMVASG IALPDNPEDL ILPTGRGVLE IGLPDEAQVC       420
     SCNDVTKGDI LAAAAAGTST RAGATCGSCK AQTKRIIEDY YASQGKVVDR SLCEHFALTR       480
     QELFDVVAVH GYTRFDDIVA GHGRGRGCDI CKPAIASILA SQLNGHVLDG PNRTLQDTND       540
     AYLANIQRNG TYSVVPRIPG GEITPEKLIV IGEVAQEFGL YTKITGGQRI DLFGARMEQL       600
     PAIWRRLVDS GFESGHAYGK SLRTVKSCVG STWCRYGVQD SVQLAIDLEL RYRGLRSPHK       660
     LKGGVSGCAR ECAEARAKDF GVIATEKGWN LYVGGNGGAT PAHARLLAGD LDRETLVRYL       720
     DRFLMYYVRT ADRLQRTASW IDSIDGGLDR VREIVVDDAL GLGSELEAAM ARHVAGYFDE       780
     WRATLDDPAK LARFVSFVNA PGTPDPHITF RSERDQAVPE ESSGPVDLGA TIPVGAPR         838
//

If you have problems or comments...

PBIL Back to PBIL home page