(data stored in ACNUC1104 zone)

EMBL: CP000509.PE347

CP000509.PE347       Location/Qualifiers
FT   CDS             379296..379673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0353"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) small
FT                   subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   fra:Francci3_0795 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79897"
FT                   /db_xref="GOA:A1SDL2"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL2"
FT                   /protein_id="ABL79897.1"
FT                   /translation="MSTSTGPAAGATYTTVCGLDQIEVEGGVVALVDGVAVAIFRTHDG
FT                   NVYAISNYDPVSRASVLARGIVGTRGDVPVVASPMHKQAYDLRTGQCLDDAAVRVPTYD
FT                   VRVIDGTVHVGGPRPEHQDST"
     MSTSTGPAAG ATYTTVCGLD QIEVEGGVVA LVDGVAVAIF RTHDGNVYAI SNYDPVSRAS        60
     VLARGIVGTR GDVPVVASPM HKQAYDLRTG QCLDDAAVRV PTYDVRVIDG TVHVGGPRPE       120
     HQDST                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page