(data stored in ACNUC1104 zone)

EMBL: CP000509.PE35

CP000509.PE35        Location/Qualifiers
FT   CDS             39113..39805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0035"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sco:SCO6565 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79585"
FT                   /db_xref="GOA:A1SCQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ0"
FT                   /protein_id="ABL79585.1"
FT                   /translation="MTTPTEVHDDKLFHQPPLRERVRVRLERMIIDGTFEPGAHLVETD
FT                   LAQRLGVSRGPIREALYQLQLQGWVDLRPRQGAFVHQPSVEEVDQFFQVRALLESEISS
FT                   LVAGHVTAADVDALRAMIEVANRHIAEGNVAALVAANAEFHGYIHRLAGNPVLVDLVQM
FT                   LDKRLRWYFSAVTMERAGDAWHEHAALVDALAEGDRARAVALTRSHNERTRSAYLTHRR
FT                   VLQAADED"
     MTTPTEVHDD KLFHQPPLRE RVRVRLERMI IDGTFEPGAH LVETDLAQRL GVSRGPIREA        60
     LYQLQLQGWV DLRPRQGAFV HQPSVEEVDQ FFQVRALLES EISSLVAGHV TAADVDALRA       120
     MIEVANRHIA EGNVAALVAA NAEFHGYIHR LAGNPVLVDL VQMLDKRLRW YFSAVTMERA       180
     GDAWHEHAAL VDALAEGDRA RAVALTRSHN ERTRSAYLTH RRVLQAADED                  230
//

If you have problems or comments...

PBIL Back to PBIL home page