(data stored in SCRATCH zone)

EMBL: CP000509.PE350

CP000509.PE350       Location/Qualifiers
FT   CDS             complement(382328..382705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79900"
FT                   /db_xref="GOA:A1SDL5"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL5"
FT                   /protein_id="ABL79900.1"
FT                   /translation="MSEPGAAPERVRVTGPPRRRTPAARTADIDDETLLGGMYMGSLLR
FT                   EQLRLAVGVLTVLGLTLGLLPLAFHLFPRLGEVEVLGAPLAWVLLGVLAYPTLLLLGWV
FT                   YVRRAERNERDFAELVSEVEG"
     MSEPGAAPER VRVTGPPRRR TPAARTADID DETLLGGMYM GSLLREQLRL AVGVLTVLGL        60
     TLGLLPLAFH LFPRLGEVEV LGAPLAWVLL GVLAYPTLLL LGWVYVRRAE RNERDFAELV       120
     SEVEG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page