(data stored in ACNUC1104 zone)

EMBL: CP000509.PE351

CP000509.PE351       Location/Qualifiers
FT   CDS             complement(382702..383451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0357"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: sma:SAV7115 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79901"
FT                   /db_xref="GOA:A1SDL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL6"
FT                   /protein_id="ABL79901.1"
FT                   /translation="MSAPAAPVPRLRALVVDDERPALDELRYLLERDDRVREVLTTDSA
FT                   TEGLRILRDLDVDVVFLDIQMPGLTGLELAQVLSRFRTPPGIVFVTAHEAHAVEAFDVH
FT                   AVDYVLKPVRADRLAEAVRRVVAGTDRAANGDDMRVAVERGGVTRFLNRSDITHVEAHG
FT                   DYARLHTGDGSHLVRTPLAALEEEWAGAGFVRIHRSLLVSLAHVREVRMDAGRCAVVVG
FT                   EPPVELGVSRRHTRELRELLLQYRTGP"
     MSAPAAPVPR LRALVVDDER PALDELRYLL ERDDRVREVL TTDSATEGLR ILRDLDVDVV        60
     FLDIQMPGLT GLELAQVLSR FRTPPGIVFV TAHEAHAVEA FDVHAVDYVL KPVRADRLAE       120
     AVRRVVAGTD RAANGDDMRV AVERGGVTRF LNRSDITHVE AHGDYARLHT GDGSHLVRTP       180
     LAALEEEWAG AGFVRIHRSL LVSLAHVREV RMDAGRCAVV VGEPPVELGV SRRHTRELRE       240
     LLLQYRTGP                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page