(data stored in ACNUC1104 zone)

EMBL: CP000509.PE356

CP000509.PE356       Location/Qualifiers
FT   CDS             388395..389441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0363"
FT                   /product="septum site determining protein"
FT                   /note="KEGG: sco:SCO3557 septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79906"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM1"
FT                   /protein_id="ABL79906.1"
FT                   /translation="MTAPLLITRDQSLLDELLRLAAAAGVTPDVASDGGAALRGWARAP
FT                   VVLLGADMAEDLARISPPRRPRVYVVSWAAVPDEMFRVAVAVGAESVAQVARSEGWLTE
FT                   LLTDLGEAAPAEGLVVGVVGGSGGAGATTFACALGQVGARRGRAVVIDADPLGPGIDRV
FT                   LGLEDRHGVRWDGLCQTTGRLSARALREALPRREQLGVLTWHAGEPAALQAFAVREVLS
FT                   AARRGHDLVVVDLPRTAGPLVDEVVARCDRLLVVVVPTVAGVASAVRTCARHPDPTGVR
FT                   LVLRGAGIDPRAVSRATGISVLTTMPDQRGLGEALDLGLGPVRSRRAALGRAATEVLDQ
FT                   LVLLRAAA"
     MTAPLLITRD QSLLDELLRL AAAAGVTPDV ASDGGAALRG WARAPVVLLG ADMAEDLARI        60
     SPPRRPRVYV VSWAAVPDEM FRVAVAVGAE SVAQVARSEG WLTELLTDLG EAAPAEGLVV       120
     GVVGGSGGAG ATTFACALGQ VGARRGRAVV IDADPLGPGI DRVLGLEDRH GVRWDGLCQT       180
     TGRLSARALR EALPRREQLG VLTWHAGEPA ALQAFAVREV LSAARRGHDL VVVDLPRTAG       240
     PLVDEVVARC DRLLVVVVPT VAGVASAVRT CARHPDPTGV RLVLRGAGID PRAVSRATGI       300
     SVLTTMPDQR GLGEALDLGL GPVRSRRAAL GRAATEVLDQ LVLLRAAA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page