(data stored in ACNUC1104 zone)

EMBL: CP000509.PE358

CP000509.PE358       Location/Qualifiers
FT   CDS             390598..391374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0365"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79908"
FT                   /db_xref="GOA:A1SDM3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM3"
FT                   /protein_id="ABL79908.1"
FT                   /translation="MTAVAVGAAALAMLLLVRPPARPAASGAAVVERRWVPVAVLVAGV
FT                   VAALAMPRLGGLALVLSGTATGAAGLWRRRRRRRAAERVAAQVLDTCELLAGELTAGRP
FT                   PGEALQRAAASWPPLARVAEAFRVGADVPSALRVLAADLEGARDLRVVAAAWQVAHRTG
FT                   QGLASAVERVAESLRAGAATRRMVTGELGSARATARLVAGLPVLALAMGSGAGGDPWGF
FT                   LLGHPAGLLCLAGGLAFGLAGLWWIEAIAAAAEESW"
     MTAVAVGAAA LAMLLLVRPP ARPAASGAAV VERRWVPVAV LVAGVVAALA MPRLGGLALV        60
     LSGTATGAAG LWRRRRRRRA AERVAAQVLD TCELLAGELT AGRPPGEALQ RAAASWPPLA       120
     RVAEAFRVGA DVPSALRVLA ADLEGARDLR VVAAAWQVAH RTGQGLASAV ERVAESLRAG       180
     AATRRMVTGE LGSARATARL VAGLPVLALA MGSGAGGDPW GFLLGHPAGL LCLAGGLAFG       240
     LAGLWWIEAI AAAAEESW                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page