(data stored in ACNUC1104 zone)

EMBL: CP000509.PE360

CP000509.PE360       Location/Qualifiers
FT   CDS             392651..393028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79910"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM5"
FT                   /protein_id="ABL79910.1"
FT                   /translation="MTGRGSGRRRERGAATAELAMALPLLVAITLGLVWLLAVGAAQVR
FT                   AVDAARETARAVARGDSVTAAVARGQRVAPPGSRVSVHDDGGQVTAVVVGRVDGPGGLF
FT                   GRLPGVAVSAQAVAAAEESSP"
     MTGRGSGRRR ERGAATAELA MALPLLVAIT LGLVWLLAVG AAQVRAVDAA RETARAVARG        60
     DSVTAAVARG QRVAPPGSRV SVHDDGGQVT AVVVGRVDGP GGLFGRLPGV AVSAQAVAAA       120
     EESSP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page