(data stored in ACNUC1104 zone)

EMBL: CP000509.PE363

CP000509.PE363       Location/Qualifiers
FT   CDS             complement(393742..396078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0370"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sco:SCO3550 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79913"
FT                   /db_xref="GOA:A1SDM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM8"
FT                   /protein_id="ABL79913.1"
FT                   /translation="MRAVLGSQARTAGDLRDVVERLVAAPGREDRLCHLEVLPARAARH
FT                   ADWPAWADPDVVAAFAARGVARPWQHQVVAAEAAHAGQHVVLATGTASGKSLAYQLPAL
FT                   STLRGSRGPRGQRGATVLYLAPTKALAQDQLAGLSGLGLDLRVTTHDGDSSREQRDWAR
FT                   DHGEYVLTNPDMLHRSLLPGHSRWAGFLGALQYVVVDECHHYRGVFGAHVAHVLRRLRR
FT                   VCATYGASPTFVLASATVAEPEAAARRLTGLDVQAVTADHSPRGRVSLLLWEPPFTSFT
FT                   GENGAPVRRAASSETADLLADLVAEDVRTLAFIRSRRGAEQVAMTAAELLTDVDPVLAG
FT                   RVASYRGGYLPEERRAIEDSLRRGEITGLAATNALELGIDISGLDAVVMAGFPGTRAAL
FT                   WQQVGRAGRGAQDALAVLVARDDPLDTYLVTHPEALLGRPVEATVFDPSNPYVLGPHLC
FT                   AAAHEAPLTEADLPLFGPTAREVVDALTEGGLLRRRPRGWFWTDRRRASDLADIRSTGG
FT                   APVQLVEAETGRVIGTVDASSAHGTAHPGAVYVHRGETWLVCSLDLEDRVAVIQRAQPD
FT                   YSTTAREVTEISVVREREHTAWGDCRLSFGEVDVTHQVVSFLKRRQPGGDVLGEEPLDL
FT                   PERSLRTAAVWWTVPDHAVTEAGLSGRDLPGAAHAAEHCSIGLLPLFATCDRWDIGGVS
FT                   TAVHPDTGRLTVFVYDGHPGGAGFAERGFRAAREWLTATRDTIRSCTCEDGCPSCIQSP
FT                   KCGNQNNPLDKAGAAALLDVLLGEA"
     MRAVLGSQAR TAGDLRDVVE RLVAAPGRED RLCHLEVLPA RAARHADWPA WADPDVVAAF        60
     AARGVARPWQ HQVVAAEAAH AGQHVVLATG TASGKSLAYQ LPALSTLRGS RGPRGQRGAT       120
     VLYLAPTKAL AQDQLAGLSG LGLDLRVTTH DGDSSREQRD WARDHGEYVL TNPDMLHRSL       180
     LPGHSRWAGF LGALQYVVVD ECHHYRGVFG AHVAHVLRRL RRVCATYGAS PTFVLASATV       240
     AEPEAAARRL TGLDVQAVTA DHSPRGRVSL LLWEPPFTSF TGENGAPVRR AASSETADLL       300
     ADLVAEDVRT LAFIRSRRGA EQVAMTAAEL LTDVDPVLAG RVASYRGGYL PEERRAIEDS       360
     LRRGEITGLA ATNALELGID ISGLDAVVMA GFPGTRAALW QQVGRAGRGA QDALAVLVAR       420
     DDPLDTYLVT HPEALLGRPV EATVFDPSNP YVLGPHLCAA AHEAPLTEAD LPLFGPTARE       480
     VVDALTEGGL LRRRPRGWFW TDRRRASDLA DIRSTGGAPV QLVEAETGRV IGTVDASSAH       540
     GTAHPGAVYV HRGETWLVCS LDLEDRVAVI QRAQPDYSTT AREVTEISVV REREHTAWGD       600
     CRLSFGEVDV THQVVSFLKR RQPGGDVLGE EPLDLPERSL RTAAVWWTVP DHAVTEAGLS       660
     GRDLPGAAHA AEHCSIGLLP LFATCDRWDI GGVSTAVHPD TGRLTVFVYD GHPGGAGFAE       720
     RGFRAAREWL TATRDTIRSC TCEDGCPSCI QSPKCGNQNN PLDKAGAAAL LDVLLGEA         778
//

If you have problems or comments...

PBIL Back to PBIL home page