(data stored in ACNUC1104 zone)

EMBL: CP000509.PE366

CP000509.PE366       Location/Qualifiers
FT   CDS             complement(399342..400832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79916"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN1"
FT                   /protein_id="ABL79916.1"
FT                   /translation="MHRITRALGASVVAALVMSGPSVAVAAPSQGGEPPSSSSAQRAGE
FT                   PTLSGSGVAGQPLTVLIDGLTTLLPVQWLRDGSPIAGATGASYVPDVTDIGHQISALVD
FT                   VPLLGGIPTPSITILAPDGGLPDLLTPPELTGTPVVGELLTVLAPVFSVPGVETTYQWL
FT                   RDGVPIPGETGGTYAPSLEDVGHEISVGVTSTLAGLPVLSTVTNILPISAIGEESLSAT
FT                   AAPTVSGTARIGKVLSVSGTQWNQDGVTTTYQWLRDGVPINGATATSYKLVPDDLDSAI
FT                   SAKATGTKDGFTNGVVTSDSKTALIGDPITWTRQPAVSGTAKVGRLLTADPGAWGTGDT
FT                   PLFGYQWKRNGVAIAGAVAQTYQIDTADFGRSLTVTITAARAGYQPGTFTTSKVAVAKR
FT                   AAVLRATLATKTIAKSQRGVLALVLKVAGVTSPTGRVKVLDGRKVVSKLKFVSGKKGKA
FT                   TVRLPRLKPGVHKLKAVYAGTATISGARSKVVKLTVKK"
     MHRITRALGA SVVAALVMSG PSVAVAAPSQ GGEPPSSSSA QRAGEPTLSG SGVAGQPLTV        60
     LIDGLTTLLP VQWLRDGSPI AGATGASYVP DVTDIGHQIS ALVDVPLLGG IPTPSITILA       120
     PDGGLPDLLT PPELTGTPVV GELLTVLAPV FSVPGVETTY QWLRDGVPIP GETGGTYAPS       180
     LEDVGHEISV GVTSTLAGLP VLSTVTNILP ISAIGEESLS ATAAPTVSGT ARIGKVLSVS       240
     GTQWNQDGVT TTYQWLRDGV PINGATATSY KLVPDDLDSA ISAKATGTKD GFTNGVVTSD       300
     SKTALIGDPI TWTRQPAVSG TAKVGRLLTA DPGAWGTGDT PLFGYQWKRN GVAIAGAVAQ       360
     TYQIDTADFG RSLTVTITAA RAGYQPGTFT TSKVAVAKRA AVLRATLATK TIAKSQRGVL       420
     ALVLKVAGVT SPTGRVKVLD GRKVVSKLKF VSGKKGKATV RLPRLKPGVH KLKAVYAGTA       480
     TISGARSKVV KLTVKK                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page