(data stored in ACNUC1104 zone)

EMBL: CP000509.PE369

CP000509.PE369       Location/Qualifiers
FT   CDS             complement(403358..404068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79919"
FT                   /db_xref="GOA:A1SDN4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN4"
FT                   /protein_id="ABL79919.1"
FT                   /translation="MTEQQIKEGYARLGDALAPPLDVTARVQRRVGVRRRRRRVGVVAG
FT                   SLVAVMAAGGGVVAATSGDDGPGDTVAVDQPQGPVSTLVMTRPDGSTYAFSDVAVTCDP
FT                   PQSAGGDTIGATGRIWMYSPMEITGSEEGNDAMVRRPFVYFEGVLAKLRQDRTFEMPVW
FT                   GPGDSDSYPITLFVADTEGGPDGNEAASSSGGSGTVRVLEASCDPTPVLRLEVDATLAS
FT                   EEGKQDLQIAGEVR"
     MTEQQIKEGY ARLGDALAPP LDVTARVQRR VGVRRRRRRV GVVAGSLVAV MAAGGGVVAA        60
     TSGDDGPGDT VAVDQPQGPV STLVMTRPDG STYAFSDVAV TCDPPQSAGG DTIGATGRIW       120
     MYSPMEITGS EEGNDAMVRR PFVYFEGVLA KLRQDRTFEM PVWGPGDSDS YPITLFVADT       180
     EGGPDGNEAA SSSGGSGTVR VLEASCDPTP VLRLEVDATL ASEEGKQDLQ IAGEVR           236
//

If you have problems or comments...

PBIL Back to PBIL home page