(data stored in ACNUC1104 zone)

EMBL: CP000509.PE371

CP000509.PE371       Location/Qualifiers
FT   CDS             404767..407484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0378"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: sma:SAV4621 putative DNA topoisomerase I;
FT                   TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain protein;
FT                   DNA topoisomerase, type IA, central domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79921"
FT                   /db_xref="GOA:A1SDN6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN6"
FT                   /protein_id="ABL79921.1"
FT                   /translation="MAHKLVIVESPAKARTIGGYLGQGYVVESSIGHIRDLPQSAADTP
FT                   AKIKDKPWGRLAVDVDNGFEPYYVVPRDKKSHIAKLKTLLKEADELYLATDEDREGEAI
FT                   AWHLLDELKPKDIPVKRMVFHEITKPAIIAAAEHPRELDMDLVEAQEARRILDRLYGYE
FT                   VSPVLWKKVMSGLSAGRVQSVATRLVVDRERERMAFRVASYWDLEGTFDAGATKEPRMF
FT                   PAKVHSVDGSRVAGGSDFGPDGLLKAKKGERVHLDRAAAEALVAALAETTYDVRSVEAK
FT                   PYRRSPYAPFRTTTLQQEASRKLGMSASVTMSVAQRLYENGFITYMRTDSTTLSGGAVE
FT                   AARAQVRELYGAEYLPDTPRTYTSKVKNAQEAHEAIRPAGDSFRTPAQTGLTGDQFRLY
FT                   ELIWMRTVASQMKDATGQSVSVRIGGVAADGRDVVFAASGRVITFHGFLKAYVEGTEGG
FT                   KRSDDDQVPLPDLHEGDAVSAASLAANGHETKPPARYTEATLIKELEDREIGRPSTYAS
FT                   IIGTILNRGYVYKKGTALVPAWLAFSVTRLLEEHFPRQVSYEFTAGMEDVLDEIAGGRK
FT                   DLKSELSEFYYGSDSVVGLKPLVDGLGEIDARELATFPIGGADAGINLRVGRYGPYLEG
FT                   PDDDGTAYARRANVPDDLPPDELTLDKAKELLANPAGEEIRLGVHPDTGLEVVAKNGRF
FT                   GPYVTEVLPEDAAQGRKKGAAKPRTGSLFKSMSLDTVTLADAVKLLSLPRVVGVAEDGE
FT                   EVTAQNGRYGPYLKKGTDSRSLASEDQLLTITLDEALRIYAQPKQRGRAAAAAPLKELG
FT                   NDPVSGQPVVVKAGRFGEYVTDGEYNATLRKEDSVESITIERAAELLAERRAKGPAKKA
FT                   AKRGAKKAPAKKAAAKKTATKKAATKKATAKKAT"
     MAHKLVIVES PAKARTIGGY LGQGYVVESS IGHIRDLPQS AADTPAKIKD KPWGRLAVDV        60
     DNGFEPYYVV PRDKKSHIAK LKTLLKEADE LYLATDEDRE GEAIAWHLLD ELKPKDIPVK       120
     RMVFHEITKP AIIAAAEHPR ELDMDLVEAQ EARRILDRLY GYEVSPVLWK KVMSGLSAGR       180
     VQSVATRLVV DRERERMAFR VASYWDLEGT FDAGATKEPR MFPAKVHSVD GSRVAGGSDF       240
     GPDGLLKAKK GERVHLDRAA AEALVAALAE TTYDVRSVEA KPYRRSPYAP FRTTTLQQEA       300
     SRKLGMSASV TMSVAQRLYE NGFITYMRTD STTLSGGAVE AARAQVRELY GAEYLPDTPR       360
     TYTSKVKNAQ EAHEAIRPAG DSFRTPAQTG LTGDQFRLYE LIWMRTVASQ MKDATGQSVS       420
     VRIGGVAADG RDVVFAASGR VITFHGFLKA YVEGTEGGKR SDDDQVPLPD LHEGDAVSAA       480
     SLAANGHETK PPARYTEATL IKELEDREIG RPSTYASIIG TILNRGYVYK KGTALVPAWL       540
     AFSVTRLLEE HFPRQVSYEF TAGMEDVLDE IAGGRKDLKS ELSEFYYGSD SVVGLKPLVD       600
     GLGEIDAREL ATFPIGGADA GINLRVGRYG PYLEGPDDDG TAYARRANVP DDLPPDELTL       660
     DKAKELLANP AGEEIRLGVH PDTGLEVVAK NGRFGPYVTE VLPEDAAQGR KKGAAKPRTG       720
     SLFKSMSLDT VTLADAVKLL SLPRVVGVAE DGEEVTAQNG RYGPYLKKGT DSRSLASEDQ       780
     LLTITLDEAL RIYAQPKQRG RAAAAAPLKE LGNDPVSGQP VVVKAGRFGE YVTDGEYNAT       840
     LRKEDSVESI TIERAAELLA ERRAKGPAKK AAKRGAKKAP AKKAAAKKTA TKKAATKKAT       900
     AKKAT                                                                   905
//

If you have problems or comments...

PBIL Back to PBIL home page