(data stored in ACNUC1104 zone)

EMBL: CP000509.PE372

CP000509.PE372       Location/Qualifiers
FT   CDS             407542..408570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0379"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sco:SCO6349
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79922"
FT                   /db_xref="GOA:A1SDN7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN7"
FT                   /protein_id="ABL79922.1"
FT                   /translation="MPAHRDKRHPTMADVAARAGVSHQTVSRVINNAPSVRPETAARVV
FT                   QAISDLGYRPNRSARLLASRHSRLIGVATWGTSHHGPQQVLLALDAAARRADYRTAVST
FT                   LHALTEQDTRDGVEELLQLGVEAVVLIIPHESMLRFATEADLGVPTVVVEGDLSRMPLT
FT                   VGVDNVQGGSLATRHLLELGHRTVVHVAGPPGWAEAAARVDGWRLELETWGRVVPPLRW
FT                   GGDWSARSGYDAGVSLARDPEVTAVFAANDQMAMGVIAALREAGRRVPDDISVVGFDDL
FT                   PESAYLDPPLTSVHQDFGELGRRAMGLLERVLAGEKKPTADLVPTSLVVRASTSSPRVP
FT                   AN"
     MPAHRDKRHP TMADVAARAG VSHQTVSRVI NNAPSVRPET AARVVQAISD LGYRPNRSAR        60
     LLASRHSRLI GVATWGTSHH GPQQVLLALD AAARRADYRT AVSTLHALTE QDTRDGVEEL       120
     LQLGVEAVVL IIPHESMLRF ATEADLGVPT VVVEGDLSRM PLTVGVDNVQ GGSLATRHLL       180
     ELGHRTVVHV AGPPGWAEAA ARVDGWRLEL ETWGRVVPPL RWGGDWSARS GYDAGVSLAR       240
     DPEVTAVFAA NDQMAMGVIA ALREAGRRVP DDISVVGFDD LPESAYLDPP LTSVHQDFGE       300
     LGRRAMGLLE RVLAGEKKPT ADLVPTSLVV RASTSSPRVP AN                          342
//

If you have problems or comments...

PBIL Back to PBIL home page