(data stored in SCRATCH zone)

EMBL: CP000509.PE373

CP000509.PE373       Location/Qualifiers
FT   CDS             408864..410567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0380"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="TIGRFAM: L-ribulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pac:PPA2319 ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79923"
FT                   /db_xref="GOA:A1SDN8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN8"
FT                   /protein_id="ABL79923.1"
FT                   /translation="MVAGVVAGAVAAGSRPELVVGVDFGTLSGRAVVVRVEDGAELGSA
FT                   THEYPHGVLDRELPDGTPLGPDWALQVPADYVDVLRVAVPAALAAAGADAAQVIAIGTD
FT                   FTACTMVPTTADGTPLNEVEGFASEPHAYVKLWKHHAAQPQADRINALAAKRGEAWLPR
FT                   YGGLISSEWEFAKGLQLLEESPETYRATAHWVEAADWIVWQLCGEYVRNACTAGYKGIF
FT                   QDGTYPTREFLAELHPDFEGFVEDLLQPVTGQLGRPAGRLTEEAAAWTGLPAGIVVAVG
FT                   NVDAHVTAPAAQSTESGQMLAIMGTSTCHIMNGAVLREVPGMCGVVDGGITQGLWGYEA
FT                   GQSGVGDIFNWFVTNAVPAAYAEEAAARGVDVHELLTEKAAAQAVGEHGLVALDWHSGN
FT                   RSVLVDHELSGLVLGLTLTTRPEDVYRALIEATAFGTRTIVETFGASGVPVTEFVAAGG
FT                   LLKNQFLMQVYADVLGMPISVITSEQGPALGSAIHAAVAAGAYPDVHAASAAMGGVERG
FT                   AYQPDPVRAAAYDALYAEYRALHDHFGRGGTEVMRRLRSIRRATHTGAQA"
     MVAGVVAGAV AAGSRPELVV GVDFGTLSGR AVVVRVEDGA ELGSATHEYP HGVLDRELPD        60
     GTPLGPDWAL QVPADYVDVL RVAVPAALAA AGADAAQVIA IGTDFTACTM VPTTADGTPL       120
     NEVEGFASEP HAYVKLWKHH AAQPQADRIN ALAAKRGEAW LPRYGGLISS EWEFAKGLQL       180
     LEESPETYRA TAHWVEAADW IVWQLCGEYV RNACTAGYKG IFQDGTYPTR EFLAELHPDF       240
     EGFVEDLLQP VTGQLGRPAG RLTEEAAAWT GLPAGIVVAV GNVDAHVTAP AAQSTESGQM       300
     LAIMGTSTCH IMNGAVLREV PGMCGVVDGG ITQGLWGYEA GQSGVGDIFN WFVTNAVPAA       360
     YAEEAAARGV DVHELLTEKA AAQAVGEHGL VALDWHSGNR SVLVDHELSG LVLGLTLTTR       420
     PEDVYRALIE ATAFGTRTIV ETFGASGVPV TEFVAAGGLL KNQFLMQVYA DVLGMPISVI       480
     TSEQGPALGS AIHAAVAAGA YPDVHAASAA MGGVERGAYQ PDPVRAAAYD ALYAEYRALH       540
     DHFGRGGTEV MRRLRSIRRA THTGAQA                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page