(data stored in ACNUC1104 zone)

EMBL: CP000509.PE374

CP000509.PE374       Location/Qualifiers
FT   CDS             410564..411280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0381"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: blo:BL0273 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79924"
FT                   /db_xref="GOA:A1SDN9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN9"
FT                   /protein_id="ABL79924.1"
FT                   /translation="MNAVVSAESREAVRRLQAEVAALHAELTRNRLVVWTAGNVSARVP
FT                   GTDLFVIKPSGVSYDELDADTMVVCDLDGTLVEGARQPSSDTAAHAYVYRHLPEVGGVV
FT                   HTHSTYATAWAARGEPIPCVLTMAADEFGGEIPIGPFALIGDDSIGRGIVETLRESRSR
FT                   AVLMQNHGPFTVGPDARSAVKAAVMVEDVARTVHVARQLGAPLPIAQEHVDALYDRYQN
FT                   VYGQTQQTQQQTGGVA"
     MNAVVSAESR EAVRRLQAEV AALHAELTRN RLVVWTAGNV SARVPGTDLF VIKPSGVSYD        60
     ELDADTMVVC DLDGTLVEGA RQPSSDTAAH AYVYRHLPEV GGVVHTHSTY ATAWAARGEP       120
     IPCVLTMAAD EFGGEIPIGP FALIGDDSIG RGIVETLRES RSRAVLMQNH GPFTVGPDAR       180
     SAVKAAVMVE DVARTVHVAR QLGAPLPIAQ EHVDALYDRY QNVYGQTQQT QQQTGGVA         238
//

If you have problems or comments...

PBIL Back to PBIL home page