(data stored in ACNUC1104 zone)

EMBL: CP000509.PE378

CP000509.PE378       Location/Qualifiers
FT   CDS             415548..416837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0385"
FT                   /product="multiple monosaccharide ABC transporter membrane
FT                   protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sco:SCO2406
FT                   putative sugar transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79928"
FT                   /db_xref="GOA:A1SDP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP3"
FT                   /protein_id="ABL79928.1"
FT                   /translation="MSTLTTTLRGNIRQYGMIIALAAIVILFQFTTDGVLLKPLNVSNL
FT                   VVQNAHILILAIGMVIVIVARHIDLSVGSVAAFVGAVGAILMTKYDVPWLLAVILCLAL
FT                   GALIGAWHGFWVAYVGIPAFIVTLASMLLFRGLTLVVLEGATVGGLPEGFKKIGNGFLP
FT                   EIGPDTDLHNLTLLLGLLVVALLVFFDFRKRTAAKRYNFEVLPIPLFALKQIVLGAVIM
FT                   EFSYLLADARGLPIVGLILFTLIGVYTFIMSRTIFGRHVYAIGGNVDAATMSGVNTKRV
FT                   DFLVMTNMGLLAGLAGLVTTARLTAANPKAGVNFELDAIAASFIGGAAVTGGVGTVIGA
FT                   IIGGLVMGVLNNGMSLNGVSIDWQQAIKGLVLLGAVAFDVWNKKRTAGSGGAGAEAEAT
FT                   PPPPDELVEEIRNLEADAGPPGHGSGAGVR"
     MSTLTTTLRG NIRQYGMIIA LAAIVILFQF TTDGVLLKPL NVSNLVVQNA HILILAIGMV        60
     IVIVARHIDL SVGSVAAFVG AVGAILMTKY DVPWLLAVIL CLALGALIGA WHGFWVAYVG       120
     IPAFIVTLAS MLLFRGLTLV VLEGATVGGL PEGFKKIGNG FLPEIGPDTD LHNLTLLLGL       180
     LVVALLVFFD FRKRTAAKRY NFEVLPIPLF ALKQIVLGAV IMEFSYLLAD ARGLPIVGLI       240
     LFTLIGVYTF IMSRTIFGRH VYAIGGNVDA ATMSGVNTKR VDFLVMTNMG LLAGLAGLVT       300
     TARLTAANPK AGVNFELDAI AASFIGGAAV TGGVGTVIGA IIGGLVMGVL NNGMSLNGVS       360
     IDWQQAIKGL VLLGAVAFDV WNKKRTAGSG GAGAEAEATP PPPDELVEEI RNLEADAGPP       420
     GHGSGAGVR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page