(data stored in ACNUC1104 zone)

EMBL: CP000509.PE379

CP000509.PE379       Location/Qualifiers
FT   CDS             417242..417910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0386"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: pac:PPA0243 putative
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79929"
FT                   /db_xref="GOA:A1SDP4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP4"
FT                   /protein_id="ABL79929.1"
FT                   /translation="MSTGPAAARPGVYADTGVFVCLEGGEGSGKSTQSGLLRDWLETQG
FT                   FEVLLTFEPGDTEVGRKLRAIVLSPETGAISDRTEALLYAADKAEHVDTVVQPALDRGA
FT                   VVITDRYVASMLAYQGAGRALDVGEVEQVARWATHDLRPHLTVVLDLEPEHGLGRFEER
FT                   DRIEGESVEFHRRVREGFLGMAAADPDHYLVLDARGDREEIAGRVRDRVAPLLDRAARR
FT                   "
     MSTGPAAARP GVYADTGVFV CLEGGEGSGK STQSGLLRDW LETQGFEVLL TFEPGDTEVG        60
     RKLRAIVLSP ETGAISDRTE ALLYAADKAE HVDTVVQPAL DRGAVVITDR YVASMLAYQG       120
     AGRALDVGEV EQVARWATHD LRPHLTVVLD LEPEHGLGRF EERDRIEGES VEFHRRVREG       180
     FLGMAAADPD HYLVLDARGD REEIAGRVRD RVAPLLDRAA RR                          222
//

If you have problems or comments...

PBIL Back to PBIL home page