(data stored in ACNUC1104 zone)

EMBL: CP000509.PE380

CP000509.PE380       Location/Qualifiers
FT   CDS             417907..419064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0387"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: pac:PPA0244 DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79930"
FT                   /db_xref="GOA:A1SDP5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP5"
FT                   /protein_id="ABL79930.1"
FT                   /translation="MTVWDGLVGQHRPSEALRAAAHGQGMSHAFLFTGPPGSGRSNAAV
FT                   AFAAALQCERPEDRGCGECHECHTVLTGSHADVAVIRTEKLSIGVDEMRDLVRRSALAP
FT                   VGRRWQIMIVEDADRLTERAWNALLKAIEEPADRTVWMLCAPTVEDVLPTVRSRCRLVT
FT                   LTTPTTDDVASFLVRADGVDAAVASYAARASQGHIGRARALARDEATRNRRREVVALPA
FT                   RLVSLRACMEAATSLAEVAKQEAELVTGELDAREKADLDAAYGVVERGRRPREYAPALR
FT                   DLEKDQKTRAKRRYLDVVDRGLMDLVSVYRDAIAVATGAAGLLVNEEIRGDVELLARVS
FT                   TPEVNLRRIAAIFEAREQMLEFNVQPMLALESMMVALVAPEVRTG"
     MTVWDGLVGQ HRPSEALRAA AHGQGMSHAF LFTGPPGSGR SNAAVAFAAA LQCERPEDRG        60
     CGECHECHTV LTGSHADVAV IRTEKLSIGV DEMRDLVRRS ALAPVGRRWQ IMIVEDADRL       120
     TERAWNALLK AIEEPADRTV WMLCAPTVED VLPTVRSRCR LVTLTTPTTD DVASFLVRAD       180
     GVDAAVASYA ARASQGHIGR ARALARDEAT RNRRREVVAL PARLVSLRAC MEAATSLAEV       240
     AKQEAELVTG ELDAREKADL DAAYGVVERG RRPREYAPAL RDLEKDQKTR AKRRYLDVVD       300
     RGLMDLVSVY RDAIAVATGA AGLLVNEEIR GDVELLARVS TPEVNLRRIA AIFEAREQML       360
     EFNVQPMLAL ESMMVALVAP EVRTG                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page