(data stored in ACNUC1104 zone)

EMBL: CP000509.PE381

CP000509.PE381       Location/Qualifiers
FT   CDS             419061..420626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0388"
FT                   /product="tripeptidyl-peptidase B, Serine peptidase, MEROPS
FT                   family S33"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: sco:SCO3540 proteinase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79931"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP6"
FT                   /protein_id="ABL79931.1"
FT                   /translation="MRRLLVVLVVVALVVGVGGVAVLVALGPGDPSDPGSAPRTDVPTT
FT                   VPEPAATQPPSPGLTPFYSQALAWSVCPDDDALCATLTVPLDYRRPRGKTIELALLKVP
FT                   AEDPGRRIGSLVVNPGGPGAPGTDYAASANTVFRQPLLDVYDIVGFDPRGTGDSAPIDC
FT                   LTDDQLDDYIATDPDPDTPAEVASYEGWVQAFGEGCAERSGRLAAHVTTIEAARDMDVL
FT                   RAALGESTMTYFGASYGTKLGATYADLFPDKVGRLVLDGAVDLSIGSRELSLEQAAGFE
FT                   TALRAYVANCVEQTDGCFLGDTVDAGLQRIRDFIDAVDAHPLRGSGDRLLDVGNAFYGI
FT                   VLPLYSREYWTILSQALRLGFQGDGSALLQLADLYNSRGPDGYRDNASEAIYAINCLDD
FT                   PYAIPPEQVPANLPDFEAASPTFGSVFAWGLTTCGGIQVHSTEKPRTVRAAGAAPIVVI
FT                   GTTRDPATPYDWAVHLAQQLDSGVLVSRDGDGHTGYNSGNDCVDEAVEAYLIDGTVPED
FT                   GLSC"
     MRRLLVVLVV VALVVGVGGV AVLVALGPGD PSDPGSAPRT DVPTTVPEPA ATQPPSPGLT        60
     PFYSQALAWS VCPDDDALCA TLTVPLDYRR PRGKTIELAL LKVPAEDPGR RIGSLVVNPG       120
     GPGAPGTDYA ASANTVFRQP LLDVYDIVGF DPRGTGDSAP IDCLTDDQLD DYIATDPDPD       180
     TPAEVASYEG WVQAFGEGCA ERSGRLAAHV TTIEAARDMD VLRAALGEST MTYFGASYGT       240
     KLGATYADLF PDKVGRLVLD GAVDLSIGSR ELSLEQAAGF ETALRAYVAN CVEQTDGCFL       300
     GDTVDAGLQR IRDFIDAVDA HPLRGSGDRL LDVGNAFYGI VLPLYSREYW TILSQALRLG       360
     FQGDGSALLQ LADLYNSRGP DGYRDNASEA IYAINCLDDP YAIPPEQVPA NLPDFEAASP       420
     TFGSVFAWGL TTCGGIQVHS TEKPRTVRAA GAAPIVVIGT TRDPATPYDW AVHLAQQLDS       480
     GVLVSRDGDG HTGYNSGNDC VDEAVEAYLI DGTVPEDGLS C                           521
//

If you have problems or comments...

PBIL Back to PBIL home page