(data stored in ACNUC1104 zone)

EMBL: CP000509.PE384

CP000509.PE384       Location/Qualifiers
FT   CDS             complement(423351..423755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0391"
FT                   /product="Limonene-1,2-epoxide hydrolase"
FT                   /note="PFAM: Limonene-1,2-epoxide hydrolase; KEGG:
FT                   nfa:nfa48080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79934"
FT                   /db_xref="GOA:A1SDP9"
FT                   /db_xref="InterPro:IPR013100"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP9"
FT                   /protein_id="ABL79934.1"
FT                   /translation="MTPEQTVRAFLEHLSRAESEAALALLDADVEWRNTAMPTFRGERV
FT                   RQMIGDMERRGVGFEVRWHHVAATGEPDNGTVLTDRTDVLRYSGWETSFRVRGTFTVQD
FT                   GRITLWDDAFSWLELLGSGVAGLGKMLTSR"
     MTPEQTVRAF LEHLSRAESE AALALLDADV EWRNTAMPTF RGERVRQMIG DMERRGVGFE        60
     VRWHHVAATG EPDNGTVLTD RTDVLRYSGW ETSFRVRGTF TVQDGRITLW DDAFSWLELL       120
     GSGVAGLGKM LTSR                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page