(data stored in ACNUC1104 zone)

EMBL: CP000509.PE389

CP000509.PE389       Location/Qualifiers
FT   CDS             427097..427459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0396"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: sma:SAV1196
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79939"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ4"
FT                   /protein_id="ABL79939.1"
FT                   /translation="MTHYLLSVHGPAERNEFGNYDSREEMEEAFAATGAFNDKLHAEGY
FT                   WVFAGGLEAASTATVVDGQGETPLITDGPYLETKELIGGFWIIDAPDLDVALDLAAQGS
FT                   KACRGKVEVRPFEGLA"
     MTHYLLSVHG PAERNEFGNY DSREEMEEAF AATGAFNDKL HAEGYWVFAG GLEAASTATV        60
     VDGQGETPLI TDGPYLETKE LIGGFWIIDA PDLDVALDLA AQGSKACRGK VEVRPFEGLA       120
//

If you have problems or comments...

PBIL Back to PBIL home page