(data stored in ACNUC1104 zone)

EMBL: CP000509.PE391

CP000509.PE391       Location/Qualifiers
FT   CDS             complement(428636..429280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0398"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: cpf:CPF_1051 L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79941"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ6"
FT                   /protein_id="ABL79941.1"
FT                   /translation="MHVSEADARAAVCEVGRRLWQRGMVAANDGNISVRVDPDSFLCTP
FT                   TGVSKGTLRPEDLPVVDGTGQLLGGGDVRPSSEIRMHLRVYAVDPQVHAVVHAHPMYST
FT                   VWAIKGEGLYGPMMPETVVAMPEVPLASYATPSTDAVPDSIEPFVLSHRACLLEHHGAL
FT                   TWGTDLEQAYLAMERLEYTAQVTFLLRQIGGARYLPAAEVARLNTIFNTGR"
     MHVSEADARA AVCEVGRRLW QRGMVAANDG NISVRVDPDS FLCTPTGVSK GTLRPEDLPV        60
     VDGTGQLLGG GDVRPSSEIR MHLRVYAVDP QVHAVVHAHP MYSTVWAIKG EGLYGPMMPE       120
     TVVAMPEVPL ASYATPSTDA VPDSIEPFVL SHRACLLEHH GALTWGTDLE QAYLAMERLE       180
     YTAQVTFLLR QIGGARYLPA AEVARLNTIF NTGR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page