(data stored in ACNUC1104 zone)

EMBL: CP000509.PE392

CP000509.PE392       Location/Qualifiers
FT   CDS             complement(429287..430168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0399"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   cch:Cag_1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79942"
FT                   /db_xref="GOA:A1SDQ7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ7"
FT                   /protein_id="ABL79942.1"
FT                   /translation="MADLEGNLAAKDFGLDRPQQVEGFHIKGASQLDFGMRHRLSRIFG
FT                   ADGRTVMLAFDHGYFQGPTSGLERVDLNIVPLAPYADALMATRGIIRSVIPASCDNALV
FT                   VRASGGPSILNDLSDERIAMDITDAVRMDAAAVAVQVFIGSDHETQSIHNLTQLVDAGL
FT                   GAGVPVLGVTAVGRDMVRDARYLGLATRIIAELGAQLVKTYYCEDFAQVTAACPVPIIM
FT                   AGGKKLPVLDALNMARKAVDEGAAGVDMGRNIFQRRDPHAMLQAVRSVVHDEWSPEKAA
FT                   ELYRDLSHGAED"
     MADLEGNLAA KDFGLDRPQQ VEGFHIKGAS QLDFGMRHRL SRIFGADGRT VMLAFDHGYF        60
     QGPTSGLERV DLNIVPLAPY ADALMATRGI IRSVIPASCD NALVVRASGG PSILNDLSDE       120
     RIAMDITDAV RMDAAAVAVQ VFIGSDHETQ SIHNLTQLVD AGLGAGVPVL GVTAVGRDMV       180
     RDARYLGLAT RIIAELGAQL VKTYYCEDFA QVTAACPVPI IMAGGKKLPV LDALNMARKA       240
     VDEGAAGVDM GRNIFQRRDP HAMLQAVRSV VHDEWSPEKA AELYRDLSHG AED              293
//

If you have problems or comments...

PBIL Back to PBIL home page