(data stored in ACNUC1104 zone)

EMBL: CP000509.PE393

CP000509.PE393       Location/Qualifiers
FT   CDS             complement(430197..430586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0400"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: btk:BT9727_2719 conserved hypothetical protein,
FT                   possible polyketide synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79943"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ8"
FT                   /protein_id="ABL79943.1"
FT                   /translation="MKSGSTNDLEYRFGDHGPAYVIRDPSSEIGVLRLRPGDDMTNHIH
FT                   HFCDESFIVLEGSATLWVGCERRYLLGVGDVYRCSPGEMHYFVNETDAPFRMVFVKSPA
FT                   SPGDTVNLPWTPGQPAPHVPETPAL"
     MKSGSTNDLE YRFGDHGPAY VIRDPSSEIG VLRLRPGDDM TNHIHHFCDE SFIVLEGSAT        60
     LWVGCERRYL LGVGDVYRCS PGEMHYFVNE TDAPFRMVFV KSPASPGDTV NLPWTPGQPA       120
     PHVPETPAL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page