(data stored in ACNUC1104 zone)

EMBL: CP000509.PE395

CP000509.PE395       Location/Qualifiers
FT   CDS             complement(432727..433446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0402"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   tte:TTE0461 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79945"
FT                   /db_xref="GOA:A1SDR0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR0"
FT                   /protein_id="ABL79945.1"
FT                   /translation="MRTRNTLASRIAEDLRGDLSAGTYGPGSRLPTEAQLSENFGVSRP
FT                   TVRAALRELEALGLVQTQHGVGTFVVEQPAVRAGLEGMDSITDSIRATGKVPGMVYATR
FT                   LLRPVLPEEAAFMGVSGDTEVLELRRKLLADGEVVAYSYDLLPATLLPDGFDIQTLEGS
FT                   LFAFLRGVLRIEPDHGVAEVHAVHSDHVGWGDEAKAHDLFVLLNQLHYAGDDRLILYSR
FT                   TYFIEGRYSFTIFRNHR"
     MRTRNTLASR IAEDLRGDLS AGTYGPGSRL PTEAQLSENF GVSRPTVRAA LRELEALGLV        60
     QTQHGVGTFV VEQPAVRAGL EGMDSITDSI RATGKVPGMV YATRLLRPVL PEEAAFMGVS       120
     GDTEVLELRR KLLADGEVVA YSYDLLPATL LPDGFDIQTL EGSLFAFLRG VLRIEPDHGV       180
     AEVHAVHSDH VGWGDEAKAH DLFVLLNQLH YAGDDRLILY SRTYFIEGRY SFTIFRNHR        239
//

If you have problems or comments...

PBIL Back to PBIL home page