(data stored in ACNUC1104 zone)

EMBL: CP000509.PE396

CP000509.PE396       Location/Qualifiers
FT   CDS             433600..434634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0403"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /note="KEGG: fal:FRAAL1411 methylthioribose-1-phosphate
FT                   isomerase (MTR-1-P isomerase); TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins; PFAM:
FT                   initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79946"
FT                   /db_xref="GOA:A1SDR1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR1"
FT                   /protein_id="ABL79946.1"
FT                   /translation="MVLALQWQEDAQTIRLLDQTLLPVEERYLDVDTVDALVAAIQSLA
FT                   VRGAPALGAVGALGVVVAMRQAEREGWDDERLQVEVDRIRLARPTAVNLAWGVDQVRAA
FT                   MPSGPETVLKMAKAVVEEDEAANRTLSRLGADWILGRTGRERVRVVTHCNTGALATSAW
FT                   GTAYGIIHELHDRGALEVVYVDETRPLLQGARLTSWELTRDEIPHLLEVDGAASSTIVR
FT                   GLVDVAIIGADRITANGDTANKVGSLALALACQRAGIPFVVAAPSSTVDLATAHGDDIA
FT                   IEERDAAEVLSLGGHPTALPSTRVYNPAFDVTPHDLISAIVTDRGVVEPAARPAPNLLA
FT                   SVAS"
     MVLALQWQED AQTIRLLDQT LLPVEERYLD VDTVDALVAA IQSLAVRGAP ALGAVGALGV        60
     VVAMRQAERE GWDDERLQVE VDRIRLARPT AVNLAWGVDQ VRAAMPSGPE TVLKMAKAVV       120
     EEDEAANRTL SRLGADWILG RTGRERVRVV THCNTGALAT SAWGTAYGII HELHDRGALE       180
     VVYVDETRPL LQGARLTSWE LTRDEIPHLL EVDGAASSTI VRGLVDVAII GADRITANGD       240
     TANKVGSLAL ALACQRAGIP FVVAAPSSTV DLATAHGDDI AIEERDAAEV LSLGGHPTAL       300
     PSTRVYNPAF DVTPHDLISA IVTDRGVVEP AARPAPNLLA SVAS                        344
//

If you have problems or comments...

PBIL Back to PBIL home page