(data stored in ACNUC1104 zone)

EMBL: CP000509.PE397

CP000509.PE397       Location/Qualifiers
FT   CDS             434682..435788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0404"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: ret:RHE_PB00122 probable sugar ABC
FT                   transporter, substrate-binding protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79947"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR2"
FT                   /protein_id="ABL79947.1"
FT                   /translation="MRMNKLIVAGVAAVSALSLAACSQGSGATTAEPKAQDSASVQAAS
FT                   GDAPAPFDQAGVRVAIVQNSGQGDYFQQYLNGTKQQAAALGIDLSVYDAQGDNATQATQ
FT                   LDQAISSGVQGIIVRHGFPDTLCPGVNKAIDQGIKVVIYDVEIQKCAPQAVQTQQSDNK
FT                   MASLVLDKMAEDIGTGKPVGYVNVAGIAPLDRRDLVWQDYLATNDWTQKFKTGKFTNST
FT                   ATDTAPMVDSVLKSNPDVVAVYAPYDELTKATLSALKQNPSLQGKVKVYGADISTADIE
FT                   LMTNPDSPWVATGATDPNAIGAAVVRTLALHMAGELDGLNVEFPPILVTQDFLRSEGIK
FT                   NMDDLRAAEPALNIADVSSADWIPAVTF"
     MRMNKLIVAG VAAVSALSLA ACSQGSGATT AEPKAQDSAS VQAASGDAPA PFDQAGVRVA        60
     IVQNSGQGDY FQQYLNGTKQ QAAALGIDLS VYDAQGDNAT QATQLDQAIS SGVQGIIVRH       120
     GFPDTLCPGV NKAIDQGIKV VIYDVEIQKC APQAVQTQQS DNKMASLVLD KMAEDIGTGK       180
     PVGYVNVAGI APLDRRDLVW QDYLATNDWT QKFKTGKFTN STATDTAPMV DSVLKSNPDV       240
     VAVYAPYDEL TKATLSALKQ NPSLQGKVKV YGADISTADI ELMTNPDSPW VATGATDPNA       300
     IGAAVVRTLA LHMAGELDGL NVEFPPILVT QDFLRSEGIK NMDDLRAAEP ALNIADVSSA       360
     DWIPAVTF                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page