(data stored in ACNUC1104 zone)

EMBL: CP000509.PE4

CP000509.PE4         Location/Qualifiers
FT   CDS             4254..5516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV4319 putative DNA
FT                   recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79554"
FT                   /db_xref="GOA:A1SCL9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCL9"
FT                   /protein_id="ABL79554.1"
FT                   /translation="MYVAHLSLHDFRSYATAEVELSPGVTAFIGRNGQGKTNLVEAIDY
FT                   LSRLSSHRVASDAPLVRAGADQAVVRAAVVRDGRTAVLEVELNPGRSNRARVNRSPLPR
FT                   ARDLVGLVRTVVFSPEDLTLVKGDPADRRRFLDDLLVLRVPRLAGVRADYDRVLRQRNT
FT                   LLKTARKGGFARKGGFARKGGFAPLGPPEGRPEGPPEGRTGGSATSGPPSRSVALDTLA
FT                   VWDAHLARTGAELLAERLALVEALRPYVGKAYETVARGATRDDAEIDYKPSFDLEGRTG
FT                   RDDLVEALLAEVERRRGDELDRGVSLVGPHRDELLLTLGHGSPDSRLPVKGYASHGESW
FT                   SFALALRLAAYDLLRADGDDPILILDDVFAELDTERRAQLADLVAGAEQVLVTAAVAAD
FT                   VPAGLAGARFAVGNGEVLREQ"
     MYVAHLSLHD FRSYATAEVE LSPGVTAFIG RNGQGKTNLV EAIDYLSRLS SHRVASDAPL        60
     VRAGADQAVV RAAVVRDGRT AVLEVELNPG RSNRARVNRS PLPRARDLVG LVRTVVFSPE       120
     DLTLVKGDPA DRRRFLDDLL VLRVPRLAGV RADYDRVLRQ RNTLLKTARK GGFARKGGFA       180
     RKGGFAPLGP PEGRPEGPPE GRTGGSATSG PPSRSVALDT LAVWDAHLAR TGAELLAERL       240
     ALVEALRPYV GKAYETVARG ATRDDAEIDY KPSFDLEGRT GRDDLVEALL AEVERRRGDE       300
     LDRGVSLVGP HRDELLLTLG HGSPDSRLPV KGYASHGESW SFALALRLAA YDLLRADGDD       360
     PILILDDVFA ELDTERRAQL ADLVAGAEQV LVTAAVAADV PAGLAGARFA VGNGEVLREQ       420
//

If you have problems or comments...

PBIL Back to PBIL home page