(data stored in ACNUC1104 zone)

EMBL: CP000509.PE40

CP000509.PE40        Location/Qualifiers
FT   CDS             45212..46573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0040"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG:
FT                   bur:Bcep18194_B1168 MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79590"
FT                   /db_xref="GOA:A1SCQ5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ5"
FT                   /protein_id="ABL79590.1"
FT                   /translation="MRTVLSTYTEQLAEYVTATTYDALPTSTVAAAKRVTLDLIGVVLP
FT                   AINYGPGSVMNQYVRETGGPGQATVVGTDIKTNAANAALANGTMAADMEQDDVHPESNL
FT                   HASSVFVPAMLGVAEELGSSGRDWINALAVAYDVGCRISIAMDNGRQYASGFHPTAVSG
FT                   TFGAAAAVARLLGLDAAGVNSTIGLTGCQAAGMLTWEMETEHYTKSFQSGVPARNAVVA
FT                   AQLAARGYVGASNTLDGKYNVFDAFSNHRNFSRLVENLGDRHEIEYTGYKFYSVCRFIH
FT                   SAIDQLLDLSAEHGFAGADIESLDVWLPHTQVPIVDHNTLITHNLQYSLAVGITDRVVE
FT                   RAQTSNERFADPALQAIAAKVTLRGADDLEALYPAHWPSRVHIRLTDGRTFDSEKHDPR
FT                   GTSFVPVTDADIVAKFEGMASQVLPAERVNQIVKIVDELETLDSIRELTALLVP"
     MRTVLSTYTE QLAEYVTATT YDALPTSTVA AAKRVTLDLI GVVLPAINYG PGSVMNQYVR        60
     ETGGPGQATV VGTDIKTNAA NAALANGTMA ADMEQDDVHP ESNLHASSVF VPAMLGVAEE       120
     LGSSGRDWIN ALAVAYDVGC RISIAMDNGR QYASGFHPTA VSGTFGAAAA VARLLGLDAA       180
     GVNSTIGLTG CQAAGMLTWE METEHYTKSF QSGVPARNAV VAAQLAARGY VGASNTLDGK       240
     YNVFDAFSNH RNFSRLVENL GDRHEIEYTG YKFYSVCRFI HSAIDQLLDL SAEHGFAGAD       300
     IESLDVWLPH TQVPIVDHNT LITHNLQYSL AVGITDRVVE RAQTSNERFA DPALQAIAAK       360
     VTLRGADDLE ALYPAHWPSR VHIRLTDGRT FDSEKHDPRG TSFVPVTDAD IVAKFEGMAS       420
     QVLPAERVNQ IVKIVDELET LDSIRELTAL LVP                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page